Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2209156..2209956 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name - Uniprot ID A0A0C6E139
Locus tag OS082_RS11265 Protein ID WP_031767738.1
Coordinates 2209492..2209956 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag OS082_RS11260 Protein ID WP_001260487.1
Coordinates 2209156..2209479 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS11195 (2204556) 2204556..2205203 - 648 WP_023180130.1 ERF family protein -
OS082_RS11200 (2205204) 2205204..2205740 - 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS082_RS11205 (2205753) 2205753..2206013 - 261 WP_000291089.1 DUF1108 family protein -
OS082_RS11210 (2206105) 2206105..2206266 - 162 WP_001619936.1 DUF1270 family protein -
OS082_RS11215 (2206259) 2206259..2206396 - 138 WP_000230552.1 hypothetical protein -
OS082_RS11220 (2206446) 2206446..2206676 + 231 WP_000395457.1 hypothetical protein -
OS082_RS11225 (2206651) 2206651..2206827 - 177 WP_267810020.1 hypothetical protein -
OS082_RS11230 (2206867) 2206867..2207091 - 225 WP_000187184.1 hypothetical protein -
OS082_RS11235 (2207092) 2207092..2207871 - 780 WP_072466105.1 phage antirepressor KilAC domain-containing protein -
OS082_RS11240 (2207928) 2207928..2208137 + 210 WP_000642492.1 hypothetical protein -
OS082_RS11245 (2208127) 2208127..2208270 - 144 WP_000939498.1 hypothetical protein -
OS082_RS11250 (2208285) 2208285..2208731 - 447 WP_031767740.1 hypothetical protein -
OS082_RS11255 (2208744) 2208744..2208992 - 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
OS082_RS11260 (2209156) 2209156..2209479 + 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
OS082_RS11265 (2209492) 2209492..2209956 + 465 WP_031767738.1 toxin Toxin
OS082_RS11270 (2209988) 2209988..2210668 + 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
OS082_RS11275 (2210875) 2210875..2212260 + 1386 WP_000861313.1 recombinase family protein -
OS082_RS11280 (2212377) 2212377..2212550 - 174 WP_000290472.1 50S ribosomal protein L32 -
OS082_RS11285 (2212630) 2212630..2213187 - 558 WP_000872158.1 DUF177 domain-containing protein -
OS082_RS11290 (2213314) 2213314..2214453 + 1140 WP_000843599.1 nucleotidyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2170442..2217422 46980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18142.45 Da        Isoelectric Point: 4.6815

>T265128 WP_031767738.1 NZ_CP113007:2209492-2209956 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT265128 WP_001260487.1 NZ_CP113007:2209156-2209479 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E139

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References