Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1146022..1146647 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS082_RS05670 Protein ID WP_001179607.1
Coordinates 1146252..1146647 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS082_RS05665 Protein ID WP_000258939.1
Coordinates 1146022..1146252 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS05600 (1141078) 1141078..1141560 + 483 WP_000833764.1 hypothetical protein -
OS082_RS05605 (1141574) 1141574..1141753 + 180 WP_000401832.1 hypothetical protein -
OS082_RS05610 (1141738) 1141738..1141923 + 186 WP_001187008.1 hypothetical protein -
OS082_RS05615 (1141939) 1141939..1142106 + 168 WP_000312832.1 hypothetical protein -
OS082_RS05620 (1142220) 1142220..1142375 + 156 WP_000792995.1 transcriptional regulator -
OS082_RS05625 (1142401) 1142401..1142673 + 273 WP_000691100.1 hypothetical protein -
OS082_RS05630 (1142688) 1142688..1143230 + 543 WP_000858632.1 hypothetical protein -
OS082_RS05635 (1143214) 1143214..1143399 + 186 WP_129760514.1 hypothetical protein -
OS082_RS05640 (1143419) 1143419..1143640 + 222 WP_000829423.1 hypothetical protein -
OS082_RS05645 (1143640) 1143640..1144365 + 726 WP_000197304.1 fructose-bisphosphatase class III -
OS082_RS05650 (1144358) 1144358..1144675 + 318 WP_001807410.1 hypothetical protein -
OS082_RS05655 (1144675) 1144675..1145325 + 651 WP_000411528.1 hypothetical protein -
OS082_RS05660 (1145325) 1145325..1145846 + 522 WP_000639078.1 metallophosphoesterase -
OS082_RS05665 (1146022) 1146022..1146252 + 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS082_RS05670 (1146252) 1146252..1146647 + 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS082_RS05675 (1146700) 1146700..1147140 + 441 WP_000889963.1 hypothetical protein -
OS082_RS05680 (1147124) 1147124..1147393 + 270 WP_000755772.1 hypothetical protein -
OS082_RS05685 (1147450) 1147450..1147944 + 495 WP_000280790.1 hypothetical protein -
OS082_RS05690 (1147948) 1147948..1148748 + 801 WP_000686449.1 metallophosphoesterase -
OS082_RS05695 (1148857) 1148857..1149579 + 723 WP_001043218.1 hypothetical protein -
OS082_RS05700 (1149794) 1149794..1150429 + 636 Protein_1123 aminoglycoside 6-adenylyltransferase -
OS082_RS05705 (1150426) 1150426..1150677 + 252 WP_002505594.1 hypothetical protein -
OS082_RS05710 (1150652) 1150652..1151092 + 441 Protein_1125 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage aph(3')-III / aac(6')-aph(2'') - 1109747..1184023 74276


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265122 WP_001179607.1 NZ_CP113007:1146252-1146647 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265122 WP_000258939.1 NZ_CP113007:1146022-1146252 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References