Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1080930..1081459 | Replicon | chromosome |
| Accession | NZ_CP113007 | ||
| Organism | Staphylococcus aureus strain Ryze | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OS082_RS05260 | Protein ID | WP_000621175.1 |
| Coordinates | 1081097..1081459 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | OS082_RS05255 | Protein ID | WP_000948331.1 |
| Coordinates | 1080930..1081100 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS082_RS05225 (1075967) | 1075967..1076527 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| OS082_RS05230 (1076735) | 1076735..1077214 | + | 480 | WP_001287088.1 | hypothetical protein | - |
| OS082_RS05235 (1077207) | 1077207..1078790 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| OS082_RS05240 (1078777) | 1078777..1079268 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
| OS082_RS05245 (1079272) | 1079272..1079631 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
| OS082_RS05250 (1079697) | 1079697..1080845 | + | 1149 | WP_001281145.1 | alanine racemase | - |
| OS082_RS05255 (1080930) | 1080930..1081100 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OS082_RS05260 (1081097) | 1081097..1081459 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OS082_RS05265 (1081808) | 1081808..1082809 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| OS082_RS05270 (1082928) | 1082928..1083254 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| OS082_RS05275 (1083256) | 1083256..1083735 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| OS082_RS05280 (1083710) | 1083710..1084480 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265121 WP_000621175.1 NZ_CP113007:1081097-1081459 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|