Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1731133..1731662 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag OS073_RS09240 Protein ID WP_000621175.1
Coordinates 1731133..1731495 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag OS073_RS09245 Protein ID WP_000948331.1
Coordinates 1731492..1731662 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS09215 (1726738) 1726738..1727910 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
OS073_RS09220 (1728112) 1728112..1728882 - 771 WP_001041103.1 RNA polymerase sigma factor SigB -
OS073_RS09225 (1728857) 1728857..1729336 - 480 WP_001190829.1 anti-sigma B factor RsbW -
OS073_RS09230 (1729338) 1729338..1729664 - 327 WP_001052491.1 anti-sigma factor antagonist -
OS073_RS09235 (1729783) 1729783..1730784 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
OS073_RS09240 (1731133) 1731133..1731495 - 363 WP_000621175.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OS073_RS09245 (1731492) 1731492..1731662 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
OS073_RS09250 (1731747) 1731747..1732895 - 1149 WP_001281145.1 alanine racemase -
OS073_RS09255 (1732961) 1732961..1733320 - 360 WP_000581200.1 holo-ACP synthase -
OS073_RS09260 (1733324) 1733324..1733815 - 492 WP_001205910.1 PH domain-containing protein -
OS073_RS09265 (1733802) 1733802..1735385 - 1584 WP_001294626.1 PH domain-containing protein -
OS073_RS09270 (1735378) 1735378..1735857 - 480 WP_001287088.1 hypothetical protein -
OS073_RS09275 (1736065) 1736065..1736625 - 561 WP_001092411.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1726738..1727910 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13441.69 Da        Isoelectric Point: 10.1654

>T265106 WP_000621175.1 NZ_CP113005:c1731495-1731133 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT265106 WP_000948331.1 NZ_CP113005:c1731662-1731492 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References