Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-doc
Location 1664614..1665239 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name doc Uniprot ID A0A380FZ43
Locus tag OS073_RS08825 Protein ID WP_001179607.1
Coordinates 1664614..1665009 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A380FXS4
Locus tag OS073_RS08830 Protein ID WP_000258939.1
Coordinates 1665009..1665239 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS08785 (1660169) 1660169..1660609 - 441 Protein_1647 GNAT family N-acetyltransferase -
OS073_RS08790 (1660584) 1660584..1660835 - 252 WP_002505594.1 hypothetical protein -
OS073_RS08795 (1660832) 1660832..1661467 - 636 Protein_1649 aminoglycoside 6-adenylyltransferase -
OS073_RS08800 (1661682) 1661682..1662404 - 723 WP_001043218.1 hypothetical protein -
OS073_RS08805 (1662513) 1662513..1663313 - 801 WP_000686449.1 metallophosphoesterase -
OS073_RS08810 (1663317) 1663317..1663811 - 495 WP_000280790.1 hypothetical protein -
OS073_RS08815 (1663868) 1663868..1664137 - 270 WP_000755772.1 hypothetical protein -
OS073_RS08820 (1664121) 1664121..1664561 - 441 WP_000889963.1 hypothetical protein -
OS073_RS08825 (1664614) 1664614..1665009 - 396 WP_001179607.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OS073_RS08830 (1665009) 1665009..1665239 - 231 WP_000258939.1 addiction module antitoxin Antitoxin
OS073_RS08835 (1665415) 1665415..1665936 - 522 WP_000639078.1 metallophosphoesterase -
OS073_RS08840 (1665936) 1665936..1666586 - 651 WP_000411528.1 hypothetical protein -
OS073_RS08845 (1666586) 1666586..1666903 - 318 WP_001807410.1 hypothetical protein -
OS073_RS08850 (1666896) 1666896..1667621 - 726 WP_000197304.1 fructose-bisphosphatase class III -
OS073_RS08855 (1667621) 1667621..1667842 - 222 WP_000829423.1 hypothetical protein -
OS073_RS08860 (1667862) 1667862..1668038 - 177 WP_000063384.1 hypothetical protein -
OS073_RS08865 (1668031) 1668031..1668573 - 543 WP_000858632.1 hypothetical protein -
OS073_RS08870 (1668588) 1668588..1668860 - 273 WP_000691100.1 hypothetical protein -
OS073_RS08875 (1668886) 1668886..1669041 - 156 WP_267789152.1 transcriptional regulator -
OS073_RS08880 (1669155) 1669155..1669322 - 168 WP_000312832.1 hypothetical protein -
OS073_RS08885 (1669338) 1669338..1669523 - 186 WP_001187008.1 hypothetical protein -
OS073_RS08890 (1669508) 1669508..1669687 - 180 WP_000401832.1 hypothetical protein -
OS073_RS08895 (1669701) 1669701..1670183 - 483 WP_000833764.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1661682..1701514 39832


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 15035.51 Da        Isoelectric Point: 9.4574

>T265105 WP_001179607.1 NZ_CP113005:c1665009-1664614 [Staphylococcus aureus]
MQNIKYLTEKQVIAINVKAIQELSPKEQVGVKVPEVLNATIEGVKQSFGGVELYETIERKAAFIYRNIAQKHAFFNANKR
TAFTSMVIFLKLNKINFNCTQDEAVQFTLKVVEDKTLTLEDIADWIKRHCK

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8617.73 Da        Isoelectric Point: 4.4501

>AT265105 WP_000258939.1 NZ_CP113005:c1665239-1665009 [Staphylococcus aureus]
MVTTRKLRRAGNSSVVSVPTEVIAALGVTNGDNLKFNIEDNKVTIEKEVNEDEEFFKLLDETFTEYNQALRKLVDI

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A380FZ43

Antitoxin

Source ID Structure
AlphaFold DB A0A380FXS4

References