Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1457483..1458259 | Replicon | chromosome |
| Accession | NZ_CP113005 | ||
| Organism | Staphylococcus aureus strain Galio | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | OS073_RS07425 | Protein ID | WP_000031108.1 |
| Coordinates | 1457483..1457635 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | OS073_RS07430 | Protein ID | WP_001251224.1 |
| Coordinates | 1457660..1458259 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS073_RS07410 (1453446) | 1453446..1454267 | + | 822 | WP_000669375.1 | RluA family pseudouridine synthase | - |
| OS073_RS07415 (1454730) | 1454730..1456115 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
| OS073_RS07420 (1456311) | 1456311..1456706 | - | 396 | WP_000901021.1 | hypothetical protein | - |
| OS073_RS07425 (1457483) | 1457483..1457635 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| OS073_RS07430 (1457660) | 1457660..1458259 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| OS073_RS07435 (1458418) | 1458418..1458888 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| OS073_RS07440 (1458893) | 1458893..1460020 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| OS073_RS07445 (1460171) | 1460171..1460893 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| OS073_RS07450 (1460886) | 1460886..1462343 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T265101 WP_000031108.1 NZ_CP113005:c1457635-1457483 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT265101 WP_001251224.1 NZ_CP113005:c1458259-1457660 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|