Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 599271..600062 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name - Uniprot ID A0A0C6E139
Locus tag OS073_RS03225 Protein ID WP_031767738.1
Coordinates 599271..599735 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag OS073_RS03230 Protein ID WP_000333630.1
Coordinates 599748..600062 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS03200 (594774) 594774..595913 - 1140 WP_000843599.1 nucleotidyltransferase -
OS073_RS03205 (596040) 596040..596597 + 558 WP_000872158.1 DUF177 domain-containing protein -
OS073_RS03210 (596677) 596677..596850 + 174 WP_000290472.1 50S ribosomal protein L32 -
OS073_RS03215 (596967) 596967..598352 - 1386 WP_000861313.1 recombinase family protein -
OS073_RS03220 (598559) 598559..599239 - 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
OS073_RS03225 (599271) 599271..599735 - 465 WP_031767738.1 toxin Toxin
OS073_RS03230 (599748) 599748..600062 - 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
OS073_RS03235 (600214) 600214..600450 + 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
OS073_RS03240 (600464) 600464..601240 + 777 WP_001148544.1 Rha family transcriptional regulator -
OS073_RS03245 (601269) 601269..601412 + 144 WP_000939498.1 hypothetical protein -
OS073_RS03250 (601402) 601402..601611 - 210 WP_000642492.1 hypothetical protein -
OS073_RS03255 (601668) 601668..602447 + 780 WP_072466105.1 phage antirepressor KilAC domain-containing protein -
OS073_RS03260 (602448) 602448..602672 + 225 WP_000187184.1 hypothetical protein -
OS073_RS03265 (602712) 602712..602888 + 177 WP_172844570.1 hypothetical protein -
OS073_RS03270 (602863) 602863..603093 - 231 WP_000395457.1 hypothetical protein -
OS073_RS03275 (603273) 603273..603434 + 162 WP_000066026.1 DUF1270 family protein -
OS073_RS03280 (603528) 603528..603788 + 261 WP_000291089.1 DUF1108 family protein -
OS073_RS03285 (603801) 603801..604337 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
OS073_RS03290 (604338) 604338..604985 + 648 WP_020444661.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 596967..639567 42600


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18142.45 Da        Isoelectric Point: 4.6815

>T265099 WP_031767738.1 NZ_CP113005:c599735-599271 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT265099 WP_000333630.1 NZ_CP113005:c600062-599748 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E139

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References