Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 357973..358450 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OS073_RS02000 Protein ID WP_000052078.1
Coordinates 357973..358161 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OS073_RS02005 Protein ID WP_001059690.1
Coordinates 358190..358450 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS01970 (354014) 354014..354484 + 471 WP_000824472.1 hypothetical protein -
OS073_RS01975 (354825) 354825..355511 + 687 WP_001548082.1 thermonuclease family protein -
OS073_RS01980 (355868) 355868..356068 + 201 WP_001059082.1 cold-shock protein -
OS073_RS01985 (356564) 356564..356782 - 219 WP_000005886.1 hypothetical protein -
OS073_RS01990 (356844) 356844..357128 - 285 WP_001004395.1 hypothetical protein -
OS073_RS01995 (357216) 357216..357785 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OS073_RS02000 (357973) 357973..358161 - 189 WP_000052078.1 hypothetical protein Toxin
OS073_RS02005 (358190) 358190..358450 - 261 WP_001059690.1 hypothetical protein Antitoxin
OS073_RS02010 (358791) 358791..358994 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OS073_RS02015 (358991) 358991..359227 - 237 WP_000368687.1 hypothetical protein -
OS073_RS02020 (359452) 359452..360033 + 582 WP_001140686.1 histidine phosphatase family protein -
OS073_RS02025 (360106) 360106..360723 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OS073_RS02030 (360878) 360878..361372 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
OS073_RS02035 (361771) 361771..362193 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
OS073_RS02040 (362341) 362341..363057 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T265098 WP_000052078.1 NZ_CP113005:c358161-357973 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT265098 WP_001059690.1 NZ_CP113005:c358450-358190 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References