Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3779782..3780467 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TIR9 |
Locus tag | ORO20_RS17765 | Protein ID | WP_003417998.1 |
Coordinates | 3780057..3780467 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ORO20_RS17760 | Protein ID | WP_003912220.1 |
Coordinates | 3779782..3780060 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS17740 (ORO20_17740) | 3775771..3777372 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
ORO20_RS17745 (ORO20_17745) | 3777389..3778093 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
ORO20_RS17750 (ORO20_17750) | 3778211..3778777 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
ORO20_RS17755 (ORO20_17755) | 3778839..3779726 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
ORO20_RS17760 (ORO20_17760) | 3779782..3780060 | + | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ORO20_RS17765 (ORO20_17765) | 3780057..3780467 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS17770 (ORO20_17770) | 3780500..3782236 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
ORO20_RS17775 (ORO20_17775) | 3782292..3783419 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
ORO20_RS17780 (ORO20_17780) | 3783439..3785028 | - | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T265097 WP_003417998.1 NZ_CP112997:3780057-3780467 [Mycobacterium tuberculosis variant bovis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|