Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3752352..3753019 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | ORO20_RS17645 | Protein ID | WP_003417916.1 |
Coordinates | 3752352..3752744 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | ORO20_RS17650 | Protein ID | WP_003912214.1 |
Coordinates | 3752744..3753019 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS17630 (ORO20_17630) | 3747722..3749560 | - | 1839 | WP_023349617.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
ORO20_RS17635 (ORO20_17635) | 3749557..3750546 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
ORO20_RS17640 (ORO20_17640) | 3750546..3751598 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
ORO20_RS17645 (ORO20_17645) | 3752352..3752744 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS17650 (ORO20_17650) | 3752744..3753019 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ORO20_RS17655 (ORO20_17655) | 3753201..3754572 | + | 1372 | Protein_3487 | ISNCY family transposase | - |
ORO20_RS17660 (ORO20_17660) | 3754762..3757005 | + | 2244 | WP_268141921.1 | PE family protein | - |
ORO20_RS17665 (ORO20_17665) | 3757076..3757948 | - | 873 | WP_268141923.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3753895..3754572 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T265096 WP_003417916.1 NZ_CP112997:c3752744-3752352 [Mycobacterium tuberculosis variant bovis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |