Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 3725230..3725759 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TI95 |
Locus tag | ORO20_RS17525 | Protein ID | WP_003417760.1 |
Coordinates | 3725502..3725759 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0TI94 |
Locus tag | ORO20_RS17520 | Protein ID | WP_003417757.1 |
Coordinates | 3725230..3725505 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS17485 (ORO20_17485) | 3721803..3722492 | - | 690 | WP_003917774.1 | BBE domain-containing protein | - |
ORO20_RS17490 (ORO20_17490) | 3722679..3723050 | - | 372 | WP_003417739.1 | FAD-binding protein | - |
ORO20_RS17495 (ORO20_17495) | 3722948..3723166 | - | 219 | WP_157132559.1 | hypothetical protein | - |
ORO20_RS17500 (ORO20_17500) | 3723193..3723453 | - | 261 | WP_003417741.1 | hypothetical protein | - |
ORO20_RS17505 (ORO20_17505) | 3723568..3723957 | + | 390 | WP_010950876.1 | DUF732 domain-containing protein | - |
ORO20_RS17510 (ORO20_17510) | 3723971..3724264 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
ORO20_RS17515 (ORO20_17515) | 3724261..3725106 | - | 846 | WP_010950877.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
ORO20_RS17520 (ORO20_17520) | 3725230..3725505 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
ORO20_RS17525 (ORO20_17525) | 3725502..3725759 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
ORO20_RS17530 (ORO20_17530) | 3725801..3726991 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
ORO20_RS17535 (ORO20_17535) | 3727108..3727476 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
ORO20_RS17540 (ORO20_17540) | 3727473..3728024 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
ORO20_RS17545 (ORO20_17545) | 3728031..3728612 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
ORO20_RS17550 (ORO20_17550) | 3728593..3728961 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
ORO20_RS17555 (ORO20_17555) | 3728939..3729331 | - | 393 | WP_003417776.1 | serine protease inhibitor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T265095 WP_003417760.1 NZ_CP112997:3725502-3725759 [Mycobacterium tuberculosis variant bovis]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|