Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3665256..3665930 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag ORO20_RS17320 Protein ID WP_003417282.1
Coordinates 3665256..3665684 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag ORO20_RS17325 Protein ID WP_003417286.1
Coordinates 3665688..3665930 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS17295 (ORO20_17295) 3661078..3661479 - 402 WP_003417264.1 cytidine deaminase -
ORO20_RS17300 (ORO20_17300) 3661716..3662054 + 339 WP_268141919.1 succinate dehydrogenase, cytochrome b556 subunit -
ORO20_RS17305 (ORO20_17305) 3662051..3662485 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
ORO20_RS17310 (ORO20_17310) 3662614..3664386 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
ORO20_RS17315 (ORO20_17315) 3664386..3665177 + 792 WP_010950870.1 succinate dehydrogenase iron-sulfur subunit -
ORO20_RS17320 (ORO20_17320) 3665256..3665684 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS17325 (ORO20_17325) 3665688..3665930 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
ORO20_RS17330 (ORO20_17330) 3666052..3666666 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
ORO20_RS17335 (ORO20_17335) 3666663..3667328 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
ORO20_RS17340 (ORO20_17340) 3667329..3667862 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
ORO20_RS17345 (ORO20_17345) 3667859..3668233 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
ORO20_RS17350 (ORO20_17350) 3668330..3669466 - 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T265094 WP_003417282.1 NZ_CP112997:c3665684-3665256 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT265094 WP_003417286.1 NZ_CP112997:c3665930-3665688 [Mycobacterium tuberculosis variant bovis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References