Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3665256..3665930 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | ORO20_RS17320 | Protein ID | WP_003417282.1 |
Coordinates | 3665256..3665684 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | ORO20_RS17325 | Protein ID | WP_003417286.1 |
Coordinates | 3665688..3665930 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS17295 (ORO20_17295) | 3661078..3661479 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
ORO20_RS17300 (ORO20_17300) | 3661716..3662054 | + | 339 | WP_268141919.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
ORO20_RS17305 (ORO20_17305) | 3662051..3662485 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
ORO20_RS17310 (ORO20_17310) | 3662614..3664386 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
ORO20_RS17315 (ORO20_17315) | 3664386..3665177 | + | 792 | WP_010950870.1 | succinate dehydrogenase iron-sulfur subunit | - |
ORO20_RS17320 (ORO20_17320) | 3665256..3665684 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS17325 (ORO20_17325) | 3665688..3665930 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
ORO20_RS17330 (ORO20_17330) | 3666052..3666666 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
ORO20_RS17335 (ORO20_17335) | 3666663..3667328 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
ORO20_RS17340 (ORO20_17340) | 3667329..3667862 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
ORO20_RS17345 (ORO20_17345) | 3667859..3668233 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
ORO20_RS17350 (ORO20_17350) | 3668330..3669466 | - | 1137 | WP_003417297.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T265094 WP_003417282.1 NZ_CP112997:c3665684-3665256 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |