265090

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3096087..3096691 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag ORO20_RS14735 Protein ID WP_003414492.1
Coordinates 3096087..3096479 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag ORO20_RS14740 Protein ID WP_003414495.1
Coordinates 3096476..3096691 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS14705 (ORO20_14705) 3091237..3092025 - 789 WP_193692467.1 CRISPR-associated endoribonuclease Cas6 -
ORO20_RS14710 (ORO20_14710) 3092359..3092904 - 546 WP_003904931.1 DUF1802 family protein -
ORO20_RS14715 (ORO20_14715) 3093176..3094060 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ORO20_RS14720 (ORO20_14720) 3094063..3094950 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
ORO20_RS14725 (ORO20_14725) 3095255..3095800 - 546 WP_010950781.1 DUF1802 family protein -
ORO20_RS14730 (ORO20_14730) 3095797..3096066 - 270 WP_003414489.1 DUF2277 family protein -
ORO20_RS14735 (ORO20_14735) 3096087..3096479 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS14740 (ORO20_14740) 3096476..3096691 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ORO20_RS14745 (ORO20_14745) 3096738..3097487 + 750 WP_003414497.1 enoyl-CoA hydratase -
ORO20_RS14750 (ORO20_14750) 3097566..3098648 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
ORO20_RS14755 (ORO20_14755) 3098641..3099951 - 1311 WP_031702645.1 ABC transporter substrate-binding protein -
ORO20_RS14760 (ORO20_14760) 3099954..3100781 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
ORO20_RS14765 (ORO20_14765) 3100778..3101688 - 911 Protein_2914 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T265090 WP_003414492.1 NZ_CP112997:c3096479-3096087 [Mycobacterium tuberculosis variant bovis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT265090 WP_003414495.1 NZ_CP112997:c3096691-3096476 [Mycobacterium tuberculosis variant bovis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References