265087

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3030025..3030712 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag ORO20_RS14370 Protein ID WP_003414064.1
Coordinates 3030317..3030712 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag ORO20_RS14365 Protein ID WP_003414061.1
Coordinates 3030025..3030291 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS14335 (ORO20_14335) 3025664..3026566 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
ORO20_RS14340 (ORO20_14340) 3026635..3027387 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
ORO20_RS14345 (ORO20_14345) 3027414..3027551 - 138 Protein_2830 type II toxin-antitoxin system VapC family toxin -
ORO20_RS14350 (ORO20_14350) 3027631..3027906 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
ORO20_RS14355 (ORO20_14355) 3027903..3029525 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
ORO20_RS14360 (ORO20_14360) 3029612..3030028 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
ORO20_RS14365 (ORO20_14365) 3030025..3030291 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORO20_RS14370 (ORO20_14370) 3030317..3030712 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS14375 (ORO20_14375) 3030709..3030978 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
ORO20_RS14380 (ORO20_14380) 3030988..3032082 - 1095 WP_003414068.1 restriction endonuclease subunit S -
ORO20_RS14385 (ORO20_14385) 3032079..3032498 - 420 Protein_2838 winged helix-turn-helix domain-containing protein -
ORO20_RS14390 (ORO20_14390) 3032497..3032571 + 75 Protein_2839 hypothetical protein -
ORO20_RS14395 (ORO20_14395) 3032572..3033051 - 480 WP_003414073.1 dihydrofolate reductase -
ORO20_RS14400 (ORO20_14400) 3033122..3033922 - 801 WP_003911953.1 thymidylate synthase -
ORO20_RS14405 (ORO20_14405) 3034078..3034815 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T265087 WP_003414064.1 NZ_CP112997:c3030712-3030317 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT265087 WP_003414061.1 NZ_CP112997:c3030291-3030025 [Mycobacterium tuberculosis variant bovis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References