Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3029612..3030291 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | ORO20_RS14360 | Protein ID | WP_003414059.1 |
Coordinates | 3029612..3030028 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | ORO20_RS14365 | Protein ID | WP_003414061.1 |
Coordinates | 3030025..3030291 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS14335 (ORO20_14335) | 3025664..3026566 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
ORO20_RS14340 (ORO20_14340) | 3026635..3027387 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
ORO20_RS14345 (ORO20_14345) | 3027414..3027551 | - | 138 | Protein_2830 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS14350 (ORO20_14350) | 3027631..3027906 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
ORO20_RS14355 (ORO20_14355) | 3027903..3029525 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
ORO20_RS14360 (ORO20_14360) | 3029612..3030028 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
ORO20_RS14365 (ORO20_14365) | 3030025..3030291 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS14370 (ORO20_14370) | 3030317..3030712 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS14375 (ORO20_14375) | 3030709..3030978 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
ORO20_RS14380 (ORO20_14380) | 3030988..3032082 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
ORO20_RS14385 (ORO20_14385) | 3032079..3032498 | - | 420 | Protein_2838 | winged helix-turn-helix domain-containing protein | - |
ORO20_RS14390 (ORO20_14390) | 3032497..3032571 | + | 75 | Protein_2839 | hypothetical protein | - |
ORO20_RS14395 (ORO20_14395) | 3032572..3033051 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
ORO20_RS14400 (ORO20_14400) | 3033122..3033922 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
ORO20_RS14405 (ORO20_14405) | 3034078..3034815 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T265086 WP_003414059.1 NZ_CP112997:c3030028-3029612 [Mycobacterium tuberculosis variant bovis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|