Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2900400..2901114 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | ORO20_RS13605 | Protein ID | WP_003413460.1 |
Coordinates | 2900674..2901114 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | ORO20_RS13600 | Protein ID | WP_003413456.1 |
Coordinates | 2900400..2900687 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS13565 (ORO20_13565) | 2895822..2896067 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
ORO20_RS13570 (ORO20_13570) | 2896064..2896468 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS13575 (ORO20_13575) | 2896685..2897305 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
ORO20_RS13580 (ORO20_13580) | 2897316..2897810 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
ORO20_RS13585 (ORO20_13585) | 2897807..2898238 | + | 432 | WP_003413445.1 | DUF4247 domain-containing protein | - |
ORO20_RS13590 (ORO20_13590) | 2898263..2898721 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
ORO20_RS13595 (ORO20_13595) | 2898718..2900289 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
ORO20_RS13600 (ORO20_13600) | 2900400..2900687 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
ORO20_RS13605 (ORO20_13605) | 2900674..2901114 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS13610 (ORO20_13610) | 2901135..2901890 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
ORO20_RS13615 (ORO20_13615) | 2902023..2902619 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
ORO20_RS13620 (ORO20_13620) | 2902627..2903472 | - | 846 | WP_010950749.1 | acyl-CoA thioesterase II | - |
ORO20_RS13625 (ORO20_13625) | 2903501..2904400 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
ORO20_RS13630 (ORO20_13630) | 2904528..2905202 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T265085 WP_003413460.1 NZ_CP112997:2900674-2901114 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |