Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2838480..2839189 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag ORO20_RS13320 Protein ID WP_003413164.1
Coordinates 2838480..2838893 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag ORO20_RS13325 Protein ID WP_003413167.1
Coordinates 2838932..2839189 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS13290 (ORO20_13290) 2834190..2834504 + 315 WP_009937839.1 hypothetical protein -
ORO20_RS13295 (ORO20_13295) 2834800..2836011 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
ORO20_RS13300 (ORO20_13300) 2836138..2836797 + 660 WP_031702625.1 LppA family lipoprotein -
ORO20_RS13305 (ORO20_13305) 2836794..2837453 + 660 WP_003900847.1 LppA family lipoprotein -
ORO20_RS13310 (ORO20_13310) 2837450..2838112 + 663 WP_003900848.1 LppA family lipoprotein -
ORO20_RS13315 (ORO20_13315) 2838109..2838387 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
ORO20_RS13320 (ORO20_13320) 2838480..2838893 + 414 WP_003413164.1 PIN domain nuclease Toxin
ORO20_RS13325 (ORO20_13325) 2838932..2839189 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
ORO20_RS13330 (ORO20_13330) 2839186..2839563 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
ORO20_RS13335 (ORO20_13335) 2839579..2839953 - 375 WP_003413177.1 hypothetical protein -
ORO20_RS13340 (ORO20_13340) 2840053..2840448 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
ORO20_RS13345 (ORO20_13345) 2840445..2840690 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
ORO20_RS13350 (ORO20_13350) 2841101..2841520 - 420 WP_003413190.1 A24 family peptidase -
ORO20_RS13355 (ORO20_13355) 2841532..2842340 - 809 Protein_2636 shikimate dehydrogenase -
ORO20_RS13360 (ORO20_13360) 2842337..2843590 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
ORO20_RS13365 (ORO20_13365) 2843583..2844095 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T265082 WP_003413164.1 NZ_CP112997:2838480-2838893 [Mycobacterium tuberculosis variant bovis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT265082 WP_003413167.1 NZ_CP112997:2838932-2839189 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References