Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2823937..2824577 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag ORO20_RS13230 Protein ID WP_003412970.1
Coordinates 2823937..2824356 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag ORO20_RS13235 Protein ID WP_003412975.1
Coordinates 2824353..2824577 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS13200 (ORO20_13200) 2819522..2820244 - 723 WP_003412957.1 DUF1906 domain-containing protein -
ORO20_RS13205 (ORO20_13205) 2820761..2820988 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
ORO20_RS13210 (ORO20_13210) 2820985..2821386 + 402 WP_003412963.1 PIN domain-containing protein -
ORO20_RS13215 (ORO20_13215) 2821421..2822341 - 921 WP_003412965.1 restriction endonuclease -
ORO20_RS13220 (ORO20_13220) 2822682..2822927 - 246 WP_162146607.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
ORO20_RS13225 (ORO20_13225) 2822986..2823936 + 951 WP_003911916.1 ERCC4 domain-containing protein -
ORO20_RS13230 (ORO20_13230) 2823937..2824356 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS13235 (ORO20_13235) 2824353..2824577 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
ORO20_RS13240 (ORO20_13240) 2824608..2827451 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
ORO20_RS13245 (ORO20_13245) 2827523..2827924 - 402 WP_003412981.1 hypothetical protein -
ORO20_RS13250 (ORO20_13250) 2827924..2828394 - 471 WP_003412985.1 transcription antitermination factor NusB -
ORO20_RS13255 (ORO20_13255) 2828397..2828960 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T265081 WP_003412970.1 NZ_CP112997:c2824356-2823937 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT265081 WP_003412975.1 NZ_CP112997:c2824577-2824353 [Mycobacterium tuberculosis variant bovis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References