Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2385546..2386075 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag ORO20_RS11175 Protein ID WP_003411124.1
Coordinates 2385546..2385863 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag ORO20_RS11180 Protein ID WP_003411127.1
Coordinates 2385860..2386075 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS11145 (ORO20_11145) 2380567..2381643 + 1077 WP_003411110.1 hypothetical protein -
ORO20_RS11150 (ORO20_11150) 2381640..2381921 + 282 WP_003411112.1 DUF5703 family protein -
ORO20_RS11155 (ORO20_11155) 2381957..2383030 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
ORO20_RS11160 (ORO20_11160) 2383035..2383565 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
ORO20_RS11165 (ORO20_11165) 2383613..2384959 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
ORO20_RS11175 (ORO20_11175) 2385546..2385863 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORO20_RS11180 (ORO20_11180) 2385860..2386075 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
ORO20_RS11185 (ORO20_11185) 2386330..2387388 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
ORO20_RS11190 (ORO20_11190) 2387518..2387874 - 357 WP_003411130.1 hypothetical protein -
ORO20_RS11195 (ORO20_11195) 2387969..2388751 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
ORO20_RS11200 (ORO20_11200) 2389019..2389309 - 291 WP_003900476.1 YggT family protein -
ORO20_RS11205 (ORO20_11205) 2389471..2390127 - 657 WP_003411133.1 cell division protein SepF -
ORO20_RS11210 (ORO20_11210) 2390193..2390969 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T265079 WP_003411124.1 NZ_CP112997:c2385863-2385546 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT265079 WP_003411127.1 NZ_CP112997:c2386075-2385860 [Mycobacterium tuberculosis variant bovis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References