Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2348766..2349461 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | ORO20_RS10970 | Protein ID | WP_003410811.1 |
Coordinates | 2348766..2349200 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | ORO20_RS10975 | Protein ID | WP_003410814.1 |
Coordinates | 2349207..2349461 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS10960 (ORO20_10960) | 2344920..2347961 | + | 3042 | WP_010950658.1 | DEAD/DEAH box helicase | - |
ORO20_RS10965 (ORO20_10965) | 2347954..2348787 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
ORO20_RS10970 (ORO20_10970) | 2348766..2349200 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS10975 (ORO20_10975) | 2349207..2349461 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
ORO20_RS10980 (ORO20_10980) | 2349477..2349734 | - | 258 | WP_003410816.1 | hypothetical protein | - |
ORO20_RS10985 (ORO20_10985) | 2350681..2350977 | + | 297 | WP_003410820.1 | PE family protein | - |
ORO20_RS10990 (ORO20_10990) | 2351033..2351764 | + | 732 | WP_003900467.1 | PPE family protein | - |
ORO20_RS10995 (ORO20_10995) | 2352304..2353050 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
ORO20_RS11000 (ORO20_11000) | 2353047..2353922 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
ORO20_RS11005 (ORO20_11005) | 2353919..2354113 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T265078 WP_003410811.1 NZ_CP112997:c2349200-2348766 [Mycobacterium tuberculosis variant bovis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |