Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2239794..2240420 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | ORO20_RS10495 | Protein ID | WP_003410075.1 |
Coordinates | 2240022..2240420 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ORO20_RS10490 | Protein ID | WP_019283586.1 |
Coordinates | 2239794..2240021 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS10480 (ORO20_10480) | 2237833..2238177 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
ORO20_RS10485 (ORO20_10485) | 2238366..2239535 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
ORO20_RS10490 (ORO20_10490) | 2239794..2240021 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS10495 (ORO20_10495) | 2240022..2240420 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
ORO20_RS10500 (ORO20_10500) | 2240603..2241034 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
ORO20_RS10505 (ORO20_10505) | 2241135..2241569 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
ORO20_RS10510 (ORO20_10510) | 2242006..2242185 | - | 180 | Protein_2077 | hypothetical protein | - |
ORO20_RS10515 (ORO20_10515) | 2242273..2242893 | + | 621 | WP_043856400.1 | IS110 family transposase | - |
ORO20_RS10520 (ORO20_10520) | 2242847..2243437 | + | 591 | WP_043856401.1 | IS110 family transposase | - |
ORO20_RS10525 (ORO20_10525) | 2243565..2244821 | - | 1257 | WP_010950642.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T265075 WP_003410075.1 NZ_CP112997:2240022-2240420 [Mycobacterium tuberculosis variant bovis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|