Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2216054..2216640 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | ORO20_RS10390 | Protein ID | WP_003410010.1 |
Coordinates | 2216054..2216398 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | ORO20_RS10395 | Protein ID | WP_003410014.1 |
Coordinates | 2216392..2216640 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS10355 (ORO20_10355) | 2211760..2212359 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
ORO20_RS10360 (ORO20_10360) | 2212775..2213203 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
ORO20_RS10365 (ORO20_10365) | 2213429..2213968 | + | 540 | WP_031702531.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
ORO20_RS10370 (ORO20_10370) | 2214488..2215048 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
ORO20_RS10375 (ORO20_10375) | 2215045..2215386 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
ORO20_RS10380 (ORO20_10380) | 2215472..2215729 | + | 258 | WP_003410006.1 | hypothetical protein | - |
ORO20_RS10385 (ORO20_10385) | 2215630..2215965 | - | 336 | WP_003410009.1 | dehydrogenase | - |
ORO20_RS10390 (ORO20_10390) | 2216054..2216398 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
ORO20_RS10395 (ORO20_10395) | 2216392..2216640 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
ORO20_RS10400 (ORO20_10400) | 2216740..2219055 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
ORO20_RS10405 (ORO20_10405) | 2219052..2219324 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
ORO20_RS10410 (ORO20_10410) | 2219377..2219733 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
ORO20_RS10415 (ORO20_10415) | 2219890..2220657 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T265074 WP_003410010.1 NZ_CP112997:c2216398-2216054 [Mycobacterium tuberculosis variant bovis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5HK3 | |
PDB | 5HK0 | |
PDB | 5HKC |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAW9 |