Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2207162..2207850 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | ORO20_RS10325 | Protein ID | WP_003409958.1 |
Coordinates | 2207162..2207581 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | ORO20_RS10330 | Protein ID | WP_003409968.1 |
Coordinates | 2207590..2207850 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS10295 (ORO20_10295) | 2202168..2202473 | + | 306 | Protein_2034 | ABC transporter permease | - |
ORO20_RS10300 (ORO20_10300) | 2202469..2202549 | + | 81 | Protein_2035 | hypothetical protein | - |
ORO20_RS10305 (ORO20_10305) | 2202657..2203505 | + | 849 | WP_010950638.1 | class I SAM-dependent methyltransferase | - |
ORO20_RS10310 (ORO20_10310) | 2203468..2204913 | - | 1446 | WP_003409946.1 | APC family permease | - |
ORO20_RS10315 (ORO20_10315) | 2205092..2205778 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
ORO20_RS10320 (ORO20_10320) | 2205969..2206937 | - | 969 | WP_003409956.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
ORO20_RS10325 (ORO20_10325) | 2207162..2207581 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS10330 (ORO20_10330) | 2207590..2207850 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS10335 (ORO20_10335) | 2207993..2209669 | + | 1677 | WP_010950639.1 | PecA family PE domain-processing aspartic protease | - |
ORO20_RS10340 (ORO20_10340) | 2209657..2210310 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
ORO20_RS10345 (ORO20_10345) | 2210425..2210655 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
ORO20_RS10350 (ORO20_10350) | 2210740..2211651 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
ORO20_RS10355 (ORO20_10355) | 2211760..2212359 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T265072 WP_003409958.1 NZ_CP112997:c2207581-2207162 [Mycobacterium tuberculosis variant bovis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |