265071

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2198148..2198692 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag ORO20_RS10265 Protein ID WP_003409896.1
Coordinates 2198148..2198444 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag ORO20_RS10270 Protein ID WP_003409899.1
Coordinates 2198441..2198692 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS10210 (ORO20_10210) 2193181..2193531 - 351 WP_003409871.1 hypothetical protein -
ORO20_RS10215 (ORO20_10215) 2193542..2194444 - 903 WP_003409874.1 hypothetical protein -
ORO20_RS10220 (ORO20_10220) 2194465..2194656 - 192 WP_003409876.1 hypothetical protein -
ORO20_RS10225 (ORO20_10225) 2194657..2194953 - 297 WP_003409877.1 hypothetical protein -
ORO20_RS10230 (ORO20_10230) 2195193..2195408 + 216 WP_003409878.1 antitoxin -
ORO20_RS10235 (ORO20_10235) 2195405..2195716 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
ORO20_RS10240 (ORO20_10240) 2195690..2196211 - 522 WP_010950637.1 hypothetical protein -
ORO20_RS10245 (ORO20_10245) 2196186..2196563 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
ORO20_RS10250 (ORO20_10250) 2196605..2197054 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
ORO20_RS10255 (ORO20_10255) 2197051..2197596 + 546 WP_003409891.1 SecB-like chaperone -
ORO20_RS10260 (ORO20_10260) 2197485..2198099 - 615 WP_003901296.1 hypothetical protein -
ORO20_RS10265 (ORO20_10265) 2198148..2198444 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORO20_RS10270 (ORO20_10270) 2198441..2198692 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
ORO20_RS10275 (ORO20_10275) 2198679..2199173 + 495 WP_003899099.1 hypothetical protein -
ORO20_RS10280 (ORO20_10280) 2199333..2199740 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
ORO20_RS10285 (ORO20_10285) 2199744..2200016 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ORO20_RS10290 (ORO20_10290) 2200049..2201269 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
ORO20_RS10295 (ORO20_10295) 2202168..2202473 + 306 Protein_2034 ABC transporter permease -
ORO20_RS10300 (ORO20_10300) 2202469..2202549 + 81 Protein_2035 hypothetical protein -
ORO20_RS10305 (ORO20_10305) 2202657..2203505 + 849 WP_010950638.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T265071 WP_003409896.1 NZ_CP112997:c2198444-2198148 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT265071 WP_003409899.1 NZ_CP112997:c2198692-2198441 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References