Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2189111..2189814 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | ORO20_RS10175 | Protein ID | WP_003409778.1 |
Coordinates | 2189111..2189440 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | ORO20_RS10180 | Protein ID | WP_003409780.1 |
Coordinates | 2189437..2189814 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS10155 (ORO20_10155) | 2185494..2186564 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
ORO20_RS10160 (ORO20_10160) | 2186561..2187076 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
ORO20_RS10165 (ORO20_10165) | 2187073..2188134 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
ORO20_RS10170 (ORO20_10170) | 2188131..2188901 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
ORO20_RS10175 (ORO20_10175) | 2189111..2189440 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ORO20_RS10180 (ORO20_10180) | 2189437..2189814 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
ORO20_RS10185 (ORO20_10185) | 2189811..2190401 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
ORO20_RS10190 (ORO20_10190) | 2190456..2191820 | + | 1365 | WP_003899094.1 | HNH endonuclease signature motif containing protein | - |
ORO20_RS10195 (ORO20_10195) | 2191975..2192427 | - | 453 | WP_010950636.1 | lipoprotein | - |
ORO20_RS10200 (ORO20_10200) | 2192491..2192892 | + | 402 | WP_003409869.1 | hypothetical protein | - |
ORO20_RS10205 (ORO20_10205) | 2192885..2193067 | - | 183 | WP_003409870.1 | hypothetical protein | - |
ORO20_RS10210 (ORO20_10210) | 2193181..2193531 | - | 351 | WP_003409871.1 | hypothetical protein | - |
ORO20_RS10215 (ORO20_10215) | 2193542..2194444 | - | 903 | WP_003409874.1 | hypothetical protein | - |
ORO20_RS10220 (ORO20_10220) | 2194465..2194656 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T265069 WP_003409778.1 NZ_CP112997:c2189440-2189111 [Mycobacterium tuberculosis variant bovis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT265069 WP_003409780.1 NZ_CP112997:c2189814-2189437 [Mycobacterium tuberculosis variant bovis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|