Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1955864..1956324 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FB26 |
Locus tag | ORO20_RS09165 | Protein ID | WP_003408531.1 |
Coordinates | 1956076..1956324 (+) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ30 |
Locus tag | ORO20_RS09160 | Protein ID | WP_003408528.1 |
Coordinates | 1955864..1956076 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS09145 (ORO20_09145) | 1952342..1953529 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
ORO20_RS09150 (ORO20_09150) | 1953816..1954100 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
ORO20_RS09155 (ORO20_09155) | 1954114..1955796 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
ORO20_RS09160 (ORO20_09160) | 1955864..1956076 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS09165 (ORO20_09165) | 1956076..1956324 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
ORO20_RS09170 (ORO20_09170) | 1956332..1957070 | + | 739 | Protein_1809 | hypothetical protein | - |
ORO20_RS09175 (ORO20_09175) | 1957164..1958864 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
ORO20_RS09180 (ORO20_09180) | 1959149..1959550 | - | 402 | WP_010950586.1 | hypothetical protein | - |
ORO20_RS09185 (ORO20_09185) | 1959540..1960151 | - | 612 | Protein_1812 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T265068 WP_003408531.1 NZ_CP112997:1956076-1956324 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB26 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CFE8 |