Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1753702..1754315 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | ORO20_RS08235 | Protein ID | WP_003407786.1 |
Coordinates | 1753911..1754315 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | ORO20_RS08230 | Protein ID | WP_009935474.1 |
Coordinates | 1753702..1753905 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS08215 (ORO20_08215) | 1748966..1751869 | + | 2904 | WP_003407779.1 | MMPL family transporter | - |
ORO20_RS08220 (ORO20_08220) | 1751879..1752325 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
ORO20_RS08225 (ORO20_08225) | 1752360..1753649 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
ORO20_RS08230 (ORO20_08230) | 1753702..1753905 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS08235 (ORO20_08235) | 1753911..1754315 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
ORO20_RS08240 (ORO20_08240) | 1754332..1756074 | - | 1743 | WP_010950559.1 | malto-oligosyltrehalose trehalohydrolase | - |
ORO20_RS08245 (ORO20_08245) | 1756067..1757558 | - | 1492 | Protein_1626 | alpha-amylase family glycosyl hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T265066 WP_003407786.1 NZ_CP112997:1753911-1754315 [Mycobacterium tuberculosis variant bovis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|