Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1383885..1384573 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0THR7 |
Locus tag | ORO20_RS06630 | Protein ID | WP_003406304.1 |
Coordinates | 1384142..1384573 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0THR6 |
Locus tag | ORO20_RS06625 | Protein ID | WP_003406302.1 |
Coordinates | 1383885..1384145 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS06605 (ORO20_06605) | 1379462..1380286 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
ORO20_RS06610 (ORO20_06610) | 1380291..1381472 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
ORO20_RS06615 (ORO20_06615) | 1381549..1382649 | - | 1101 | WP_010950508.1 | magnesium/cobalt transporter CorA | - |
ORO20_RS06620 (ORO20_06620) | 1382820..1383809 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
ORO20_RS06625 (ORO20_06625) | 1383885..1384145 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
ORO20_RS06630 (ORO20_06630) | 1384142..1384573 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS06635 (ORO20_06635) | 1384596..1386285 | - | 1690 | Protein_1309 | PE family protein | - |
ORO20_RS06640 (ORO20_06640) | 1386465..1387325 | + | 861 | WP_003406306.1 | glycine betaine ABC transporter substrate-binding protein | - |
ORO20_RS06645 (ORO20_06645) | 1387406..1388236 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
ORO20_RS06650 (ORO20_06650) | 1388293..1388586 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
ORO20_RS06655 (ORO20_06655) | 1388583..1388852 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T265061 WP_003406304.1 NZ_CP112997:1384142-1384573 [Mycobacterium tuberculosis variant bovis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|