Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1230327..1230958 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | ORO20_RS05900 | Protein ID | WP_003405820.1 |
Coordinates | 1230327..1230638 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | ORO20_RS05905 | Protein ID | WP_003405836.1 |
Coordinates | 1230638..1230958 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS05880 (ORO20_05880) | 1225809..1227233 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
ORO20_RS05885 (ORO20_05885) | 1227264..1228352 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
ORO20_RS05890 (ORO20_05890) | 1228408..1229052 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
ORO20_RS05895 (ORO20_05895) | 1229059..1230215 | - | 1157 | Protein_1161 | AI-2E family transporter | - |
ORO20_RS05900 (ORO20_05900) | 1230327..1230638 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
ORO20_RS05905 (ORO20_05905) | 1230638..1230958 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
ORO20_RS05910 (ORO20_05910) | 1230968..1232504 | + | 1537 | Protein_1164 | carboxylesterase/lipase family protein | - |
ORO20_RS05915 (ORO20_05915) | 1232511..1233623 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
ORO20_RS05920 (ORO20_05920) | 1233633..1233890 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
ORO20_RS05925 (ORO20_05925) | 1233880..1235127 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
ORO20_RS05930 (ORO20_05930) | 1235124..1235762 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T265059 WP_003405820.1 NZ_CP112997:c1230638-1230327 [Mycobacterium tuberculosis variant bovis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Download Length: 107 a.a. Molecular weight: 11394.83 Da Isoelectric Point: 5.1236
>AT265059 WP_003405836.1 NZ_CP112997:c1230958-1230638 [Mycobacterium tuberculosis variant bovis]
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
Download Length: 321 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |