Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1013269..1013888 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | ORO20_RS04825 | Protein ID | WP_003404726.1 |
Coordinates | 1013454..1013888 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
Locus tag | ORO20_RS04820 | Protein ID | WP_003404724.1 |
Coordinates | 1013269..1013448 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS04805 (ORO20_04805) | 1008742..1010322 | + | 1581 | WP_011799139.1 | serine hydrolase | - |
ORO20_RS04810 (ORO20_04810) | 1010319..1012712 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
ORO20_RS04815 (ORO20_04815) | 1012985..1013143 | + | 159 | WP_003404720.1 | hypothetical protein | - |
ORO20_RS04820 (ORO20_04820) | 1013269..1013448 | + | 180 | WP_003404724.1 | antitoxin | Antitoxin |
ORO20_RS04825 (ORO20_04825) | 1013454..1013888 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
ORO20_RS04830 (ORO20_04830) | 1013986..1014759 | + | 774 | WP_003404735.1 | VOC family protein | - |
ORO20_RS04835 (ORO20_04835) | 1014824..1015273 | + | 450 | WP_003404738.1 | hypothetical protein | - |
ORO20_RS04840 (ORO20_04840) | 1015408..1015638 | - | 231 | WP_003898642.1 | hypothetical protein | - |
ORO20_RS04845 (ORO20_04845) | 1015805..1017313 | - | 1509 | WP_268141996.1 | carotenoid oxygenase family protein | - |
ORO20_RS04850 (ORO20_04850) | 1017315..1018553 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T265056 WP_003404726.1 NZ_CP112997:1013454-1013888 [Mycobacterium tuberculosis variant bovis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|