Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-mazE/PIN(toxin)
Location 754711..755503 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID P9WFB2
Locus tag ORO20_RS03505 Protein ID WP_003403386.1
Coordinates 755066..755503 (-) Length 146 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID G0TQE0
Locus tag ORO20_RS03500 Protein ID WP_003403381.1
Coordinates 754711..754956 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS03470 (ORO20_03470) 749731..751236 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
ORO20_RS03475 (ORO20_03475) 751317..752327 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
ORO20_RS03480 (ORO20_03480) 752715..753098 - 384 WP_003403365.1 ribonuclease VapC6 -
ORO20_RS03485 (ORO20_03485) 753193..753348 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
ORO20_RS03490 (ORO20_03490) 753424..754140 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
ORO20_RS03495 (ORO20_03495) 754416..754724 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
ORO20_RS03500 (ORO20_03500) 754711..754956 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family Antitoxin
ORO20_RS03505 (ORO20_03505) 755066..755503 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS03510 (ORO20_03510) 755500..755754 - 255 WP_003911263.1 antitoxin VapB7 -
ORO20_RS03515 (ORO20_03515) 755868..758231 + 2364 WP_031702437.1 arylsulfatase AtsD -
ORO20_RS03520 (ORO20_03520) 758294..758620 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ORO20_RS03525 (ORO20_03525) 758532..758870 + 339 WP_003403405.1 PIN domain-containing protein -
ORO20_RS03530 (ORO20_03530) 758867..759040 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-126)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 15245.39 Da        Isoelectric Point: 5.1865

>T265053 WP_003403386.1 NZ_CP112997:c755503-755066 [Mycobacterium tuberculosis variant bovis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR

Download         Length: 438 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9169.01 Da        Isoelectric Point: 4.2070

>AT265053 WP_003403381.1 NZ_CP112997:c754956-754711 [Mycobacterium tuberculosis variant bovis]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAA
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSW5

Antitoxin

Source ID Structure
AlphaFold DB G0TQE0

References