Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 754416..754956 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WII0 |
Locus tag | ORO20_RS03495 | Protein ID | WP_003403376.1 |
Coordinates | 754416..754724 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TQE0 |
Locus tag | ORO20_RS03500 | Protein ID | WP_003403381.1 |
Coordinates | 754711..754956 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS03470 (ORO20_03470) | 749731..751236 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
ORO20_RS03475 (ORO20_03475) | 751317..752327 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
ORO20_RS03480 (ORO20_03480) | 752715..753098 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
ORO20_RS03485 (ORO20_03485) | 753193..753348 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
ORO20_RS03490 (ORO20_03490) | 753424..754140 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
ORO20_RS03495 (ORO20_03495) | 754416..754724 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ORO20_RS03500 (ORO20_03500) | 754711..754956 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
ORO20_RS03505 (ORO20_03505) | 755066..755503 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS03510 (ORO20_03510) | 755500..755754 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
ORO20_RS03515 (ORO20_03515) | 755868..758231 | + | 2364 | WP_031702437.1 | arylsulfatase AtsD | - |
ORO20_RS03520 (ORO20_03520) | 758294..758620 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ORO20_RS03525 (ORO20_03525) | 758532..758870 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
ORO20_RS03530 (ORO20_03530) | 758867..759040 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T265052 WP_003403376.1 NZ_CP112997:c754724-754416 [Mycobacterium tuberculosis variant bovis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSE5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQE0 |