265051

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 752715..753348 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag ORO20_RS03480 Protein ID WP_003403365.1
Coordinates 752715..753098 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag ORO20_RS03485 Protein ID WP_003403368.1
Coordinates 753193..753348 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS03455 (ORO20_03455) 748007..748543 + 537 WP_003403341.1 50S ribosomal protein L10 -
ORO20_RS03460 (ORO20_03460) 748580..748972 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
ORO20_RS03465 (ORO20_03465) 748965..749660 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
ORO20_RS03470 (ORO20_03470) 749731..751236 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
ORO20_RS03475 (ORO20_03475) 751317..752327 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
ORO20_RS03480 (ORO20_03480) 752715..753098 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
ORO20_RS03485 (ORO20_03485) 753193..753348 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORO20_RS03490 (ORO20_03490) 753424..754140 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
ORO20_RS03495 (ORO20_03495) 754416..754724 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
ORO20_RS03500 (ORO20_03500) 754711..754956 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
ORO20_RS03505 (ORO20_03505) 755066..755503 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
ORO20_RS03510 (ORO20_03510) 755500..755754 - 255 WP_003911263.1 antitoxin VapB7 -
ORO20_RS03515 (ORO20_03515) 755868..758231 + 2364 WP_031702437.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T265051 WP_003403365.1 NZ_CP112997:c753098-752715 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT265051 WP_003403368.1 NZ_CP112997:c753348-753193 [Mycobacterium tuberculosis variant bovis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References