Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 715618..716267 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | ORO20_RS03295 | Protein ID | WP_003403236.1 |
Coordinates | 715872..716267 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | ORO20_RS03290 | Protein ID | WP_003403235.1 |
Coordinates | 715618..715872 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS03265 (ORO20_03265) | 710743..710826 | + | 84 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
ORO20_RS03270 (ORO20_03270) | 710845..711927 | + | 1083 | WP_031702118.1 | galactose-1-phosphate uridylyltransferase | - |
ORO20_RS03275 (ORO20_03275) | 711924..713015 | + | 1092 | WP_003403225.1 | galactokinase | - |
ORO20_RS03280 (ORO20_03280) | 713410..714567 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
ORO20_RS03285 (ORO20_03285) | 714578..715525 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
ORO20_RS03290 (ORO20_03290) | 715618..715872 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
ORO20_RS03295 (ORO20_03295) | 715872..716267 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
ORO20_RS03300 (ORO20_03300) | 716361..717101 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
ORO20_RS03305 (ORO20_03305) | 717233..717493 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ORO20_RS03310 (ORO20_03310) | 717490..717897 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS03315 (ORO20_03315) | 717969..719120 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
ORO20_RS03320 (ORO20_03320) | 719213..720940 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T265049 WP_003403236.1 NZ_CP112997:715872-716267 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ | |
AlphaFold DB | A0A7U4BSC2 |