Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 702451..703094 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | ORO20_RS03210 | Protein ID | WP_003403187.1 |
Coordinates | 702693..703094 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | ORO20_RS03205 | Protein ID | WP_003403184.1 |
Coordinates | 702451..702696 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS03170 (ORO20_03170) | 697731..698261 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
ORO20_RS03175 (ORO20_03175) | 698245..698940 | - | 696 | WP_197044064.1 | two-component system response regulator TcrA | - |
ORO20_RS03180 (ORO20_03180) | 699063..699374 | + | 312 | WP_003403164.1 | hypothetical protein | - |
ORO20_RS03185 (ORO20_03185) | 699446..700396 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
ORO20_RS03190 (ORO20_03190) | 700637..701221 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
ORO20_RS03195 (ORO20_03195) | 701223..701933 | + | 711 | Protein_633 | IS607 family element RNA-guided endonuclease TnpB | - |
ORO20_RS03200 (ORO20_03200) | 701936..702406 | + | 471 | WP_003898523.1 | hypothetical protein | - |
ORO20_RS03205 (ORO20_03205) | 702451..702696 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORO20_RS03210 (ORO20_03210) | 702693..703094 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO20_RS03215 (ORO20_03215) | 703085..703264 | + | 180 | Protein_637 | hypothetical protein | - |
ORO20_RS03220 (ORO20_03220) | 703682..703879 | - | 198 | WP_003403191.1 | hypothetical protein | - |
ORO20_RS03225 (ORO20_03225) | 703959..705116 | - | 1158 | WP_003403193.1 | hypothetical protein | - |
ORO20_RS03230 (ORO20_03230) | 705168..705389 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
ORO20_RS03235 (ORO20_03235) | 705531..706136 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T265047 WP_003403187.1 NZ_CP112997:702693-703094 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |