265046

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 696361..697007 Replicon chromosome
Accession NZ_CP112997
Organism Mycobacterium tuberculosis variant bovis strain 2016/0386

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag ORO20_RS03155 Protein ID WP_003403137.1
Coordinates 696361..696774 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag ORO20_RS03160 Protein ID WP_003403139.1
Coordinates 696771..697007 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO20_RS03135 (ORO20_03135) 692444..693994 + 1551 WP_003403119.1 MlaD family protein -
ORO20_RS03140 (ORO20_03140) 694046..694438 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
ORO20_RS03145 (ORO20_03145) 694435..694692 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
ORO20_RS03150 (ORO20_03150) 694875..696110 - 1236 WP_003403128.1 ATP-binding protein -
ORO20_RS03155 (ORO20_03155) 696361..696774 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO20_RS03160 (ORO20_03160) 696771..697007 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
ORO20_RS03165 (ORO20_03165) 697111..697617 - 507 WP_003900973.1 two component system sensor kinase HK1 -
ORO20_RS03170 (ORO20_03170) 697731..698261 - 531 WP_003917320.1 two component system sensor kinase HK2 -
ORO20_RS03175 (ORO20_03175) 698245..698940 - 696 WP_197044064.1 two-component system response regulator TcrA -
ORO20_RS03180 (ORO20_03180) 699063..699374 + 312 WP_003403164.1 hypothetical protein -
ORO20_RS03185 (ORO20_03185) 699446..700396 + 951 WP_003907436.1 DUF1259 domain-containing protein -
ORO20_RS03190 (ORO20_03190) 700637..701221 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
ORO20_RS03195 (ORO20_03195) 701223..701933 + 711 Protein_633 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T265046 WP_003403137.1 NZ_CP112997:c696774-696361 [Mycobacterium tuberculosis variant bovis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT265046 WP_003403139.1 NZ_CP112997:c697007-696771 [Mycobacterium tuberculosis variant bovis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References