Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 694046..694692 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | ORO20_RS03140 | Protein ID | WP_003403122.1 |
Coordinates | 694046..694438 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | ORO20_RS03145 | Protein ID | WP_003403125.1 |
Coordinates | 694435..694692 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS03125 (ORO20_03125) | 689707..691234 | + | 1528 | Protein_619 | virulence factor Mce family protein | - |
ORO20_RS03130 (ORO20_03130) | 691297..692439 | + | 1143 | Protein_620 | virulence factor Mce family protein | - |
ORO20_RS03135 (ORO20_03135) | 692444..693994 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
ORO20_RS03140 (ORO20_03140) | 694046..694438 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
ORO20_RS03145 (ORO20_03145) | 694435..694692 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
ORO20_RS03150 (ORO20_03150) | 694875..696110 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
ORO20_RS03155 (ORO20_03155) | 696361..696774 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS03160 (ORO20_03160) | 696771..697007 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
ORO20_RS03165 (ORO20_03165) | 697111..697617 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
ORO20_RS03170 (ORO20_03170) | 697731..698261 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
ORO20_RS03175 (ORO20_03175) | 698245..698940 | - | 696 | WP_197044064.1 | two-component system response regulator TcrA | - |
ORO20_RS03180 (ORO20_03180) | 699063..699374 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T265045 WP_003403122.1 NZ_CP112997:c694438-694046 [Mycobacterium tuberculosis variant bovis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |