Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0299-vapB/- |
Location | 362615..363186 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | ORO20_RS01585 | Protein ID | WP_003401560.1 |
Coordinates | 362615..362917 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | ORO20_RS01590 | Protein ID | WP_003401563.1 |
Coordinates | 362965..363186 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS01565 (ORO20_01565) | 358039..358842 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
ORO20_RS01570 (ORO20_01570) | 358852..360249 | - | 1398 | WP_003401544.1 | sulfatase | - |
ORO20_RS01575 (ORO20_01575) | 360428..362248 | + | 1821 | WP_268141962.1 | PE family protein | - |
ORO20_RS01580 (ORO20_01580) | 362391..362618 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
ORO20_RS01585 (ORO20_01585) | 362615..362917 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
ORO20_RS01590 (ORO20_01590) | 362965..363186 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
ORO20_RS01595 (ORO20_01595) | 363183..363608 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
ORO20_RS01600 (ORO20_01600) | 363743..364375 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
ORO20_RS01605 (ORO20_01605) | 364372..365280 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
ORO20_RS01610 (ORO20_01610) | 365288..365878 | - | 591 | WP_234712434.1 | hypothetical protein | - |
ORO20_RS01615 (ORO20_01615) | 365871..365921 | - | 51 | Protein_319 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T265041 WP_003401560.1 NZ_CP112997:362615-362917 [Mycobacterium tuberculosis variant bovis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|