Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 71616..72249 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFC0 |
Locus tag | ORO20_RS00365 | Protein ID | WP_003400580.1 |
Coordinates | 71848..72249 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A7U4BR76 |
Locus tag | ORO20_RS00360 | Protein ID | WP_011799070.1 |
Coordinates | 71616..71855 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS00345 (ORO20_00345) | 66913..68352 | + | 1440 | WP_003901784.1 | FAD-binding oxidoreductase | - |
ORO20_RS00350 (ORO20_00350) | 68408..68569 | + | 162 | WP_003899796.1 | hypothetical protein | - |
ORO20_RS00355 (ORO20_00355) | 68610..71549 | + | 2940 | WP_003901785.1 | UPF0182 family protein | - |
ORO20_RS00360 (ORO20_00360) | 71616..71855 | + | 240 | WP_011799070.1 | hypothetical protein | Antitoxin |
ORO20_RS00365 (ORO20_00365) | 71848..72249 | + | 402 | WP_003400580.1 | type II toxin-antitoxin system ribonuclease VapC1 | Toxin |
ORO20_RS00370 (ORO20_00370) | 72301..74538 | - | 2238 | WP_003400583.1 | NADP-dependent isocitrate dehydrogenase | - |
ORO20_RS00375 (ORO20_00375) | 74656..75225 | - | 570 | WP_003400591.1 | TetR/AcrR family transcriptional regulator | - |
ORO20_RS00380 (ORO20_00380) | 75328..76239 | + | 912 | WP_003899798.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.44 Da Isoelectric Point: 4.8887
>T265039 WP_003400580.1 NZ_CP112997:71848-72249 [Mycobacterium tuberculosis variant bovis]
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BR82 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BR76 |