Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3755794..3756461 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | ORO19_RS17635 | Protein ID | WP_003417916.1 |
Coordinates | 3755794..3756186 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | ORO19_RS17640 | Protein ID | WP_003912214.1 |
Coordinates | 3756186..3756461 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS17620 (ORO19_17620) | 3751164..3753002 | - | 1839 | WP_023349617.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
ORO19_RS17625 (ORO19_17625) | 3752999..3753988 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
ORO19_RS17630 (ORO19_17630) | 3753988..3755040 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
ORO19_RS17635 (ORO19_17635) | 3755794..3756186 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS17640 (ORO19_17640) | 3756186..3756461 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ORO19_RS17645 (ORO19_17645) | 3756643..3758014 | + | 1372 | Protein_3485 | ISNCY family transposase | - |
ORO19_RS17650 (ORO19_17650) | 3758204..3760447 | + | 2244 | WP_043856435.1 | PE family protein | - |
ORO19_RS17655 (ORO19_17655) | 3760518..3761390 | - | 873 | WP_010950882.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3757337..3758014 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T265038 WP_003417916.1 NZ_CP112996:c3756186-3755794 [Mycobacterium tuberculosis variant bovis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |