Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3666970..3667644 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag ORO19_RS17315 Protein ID WP_003417282.1
Coordinates 3666970..3667398 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag ORO19_RS17320 Protein ID WP_003417286.1
Coordinates 3667402..3667644 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS17290 (ORO19_17290) 3662792..3663193 - 402 WP_003417264.1 cytidine deaminase -
ORO19_RS17295 (ORO19_17295) 3663430..3663768 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
ORO19_RS17300 (ORO19_17300) 3663765..3664199 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
ORO19_RS17305 (ORO19_17305) 3664328..3666100 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
ORO19_RS17310 (ORO19_17310) 3666100..3666891 + 792 WP_010950870.1 succinate dehydrogenase iron-sulfur subunit -
ORO19_RS17315 (ORO19_17315) 3666970..3667398 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO19_RS17320 (ORO19_17320) 3667402..3667644 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
ORO19_RS17325 (ORO19_17325) 3667766..3668380 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
ORO19_RS17330 (ORO19_17330) 3668377..3669042 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
ORO19_RS17335 (ORO19_17335) 3669043..3669576 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
ORO19_RS17340 (ORO19_17340) 3669573..3669947 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
ORO19_RS17345 (ORO19_17345) 3670044..3671180 - 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T265036 WP_003417282.1 NZ_CP112996:c3667398-3666970 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT265036 WP_003417286.1 NZ_CP112996:c3667644-3667402 [Mycobacterium tuberculosis variant bovis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References