Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3143732..3144419 | Replicon | chromosome |
| Accession | NZ_CP112996 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | ORO19_RS14960 | Protein ID | WP_003414624.1 |
| Coordinates | 3143976..3144419 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | ORO19_RS14955 | Protein ID | WP_003414620.1 |
| Coordinates | 3143732..3143989 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO19_RS14935 (ORO19_14935) | 3139052..3139906 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| ORO19_RS14940 (ORO19_14940) | 3139962..3141125 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| ORO19_RS14945 (ORO19_14945) | 3141142..3142356 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| ORO19_RS14950 (ORO19_14950) | 3142364..3143605 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| ORO19_RS14955 (ORO19_14955) | 3143732..3143989 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| ORO19_RS14960 (ORO19_14960) | 3143976..3144419 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ORO19_RS14965 (ORO19_14965) | 3144499..3145161 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| ORO19_RS14970 (ORO19_14970) | 3145257..3145448 | + | 192 | WP_023349587.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| ORO19_RS14975 (ORO19_14975) | 3145780..3147528 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| ORO19_RS14980 (ORO19_14980) | 3147624..3148205 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| ORO19_RS14985 (ORO19_14985) | 3148305..3148571 | + | 267 | WP_031652375.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T265034 WP_003414624.1 NZ_CP112996:3143976-3144419 [Mycobacterium tuberculosis variant bovis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|