Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3138131..3138679 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | ORO19_RS14930 | Protein ID | WP_003414602.1 |
Coordinates | 3138416..3138679 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | ORO19_RS14925 | Protein ID | WP_003414599.1 |
Coordinates | 3138131..3138412 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS14900 (ORO19_14900) | 3133754..3134611 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
ORO19_RS14905 (ORO19_14905) | 3134653..3135237 | - | 585 | WP_010950792.1 | DUF1707 domain-containing protein | - |
ORO19_RS14910 (ORO19_14910) | 3135341..3135589 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
ORO19_RS14915 (ORO19_14915) | 3135586..3135966 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO19_RS14920 (ORO19_14920) | 3136048..3137859 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
ORO19_RS14925 (ORO19_14925) | 3138131..3138412 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
ORO19_RS14930 (ORO19_14930) | 3138416..3138679 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ORO19_RS14935 (ORO19_14935) | 3139052..3139906 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
ORO19_RS14940 (ORO19_14940) | 3139962..3141125 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
ORO19_RS14945 (ORO19_14945) | 3141142..3142356 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
ORO19_RS14950 (ORO19_14950) | 3142364..3143605 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T265033 WP_003414602.1 NZ_CP112996:3138416-3138679 [Mycobacterium tuberculosis variant bovis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O | |
AlphaFold DB | A0A7U4BWP8 |