Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3071318..3071888 | Replicon | chromosome |
| Accession | NZ_CP112996 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | ORO19_RS14585 | Protein ID | WP_003414166.1 |
| Coordinates | 3071318..3071674 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | ORO19_RS14590 | Protein ID | WP_003901465.1 |
| Coordinates | 3071658..3071888 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO19_RS14565 (ORO19_14565) | 3066764..3068452 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| ORO19_RS14570 (ORO19_14570) | 3068456..3068782 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| ORO19_RS14575 (ORO19_14575) | 3068955..3069548 | + | 594 | WP_178136156.1 | DUF3558 family protein | - |
| ORO19_RS14580 (ORO19_14580) | 3069567..3071216 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| ORO19_RS14585 (ORO19_14585) | 3071318..3071674 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| ORO19_RS14590 (ORO19_14590) | 3071658..3071888 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| ORO19_RS14595 (ORO19_14595) | 3071931..3072974 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| ORO19_RS14600 (ORO19_14600) | 3072973..3073440 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| ORO19_RS14605 (ORO19_14605) | 3073616..3073870 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| ORO19_RS14610 (ORO19_14610) | 3074018..3074422 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| ORO19_RS14615 (ORO19_14615) | 3074419..3074610 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| ORO19_RS14620 (ORO19_14620) | 3074827..3075087 | + | 261 | Protein_2885 | transposase | - |
| ORO19_RS14625 (ORO19_14625) | 3076197..3076454 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| ORO19_RS14630 (ORO19_14630) | 3076559..3076870 | + | 312 | WP_010950777.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T265030 WP_003414166.1 NZ_CP112996:c3071674-3071318 [Mycobacterium tuberculosis variant bovis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|