Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3031727..3032414 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag ORO19_RS14365 Protein ID WP_003414064.1
Coordinates 3032019..3032414 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag ORO19_RS14360 Protein ID WP_003414061.1
Coordinates 3031727..3031993 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS14330 (ORO19_14330) 3027366..3028268 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
ORO19_RS14335 (ORO19_14335) 3028337..3029089 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
ORO19_RS14340 (ORO19_14340) 3029116..3029253 - 138 Protein_2829 type II toxin-antitoxin system VapC family toxin -
ORO19_RS14345 (ORO19_14345) 3029333..3029608 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
ORO19_RS14350 (ORO19_14350) 3029605..3031227 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
ORO19_RS14355 (ORO19_14355) 3031314..3031730 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
ORO19_RS14360 (ORO19_14360) 3031727..3031993 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORO19_RS14365 (ORO19_14365) 3032019..3032414 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO19_RS14370 (ORO19_14370) 3032411..3032680 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
ORO19_RS14375 (ORO19_14375) 3032690..3033784 - 1095 WP_003414068.1 restriction endonuclease subunit S -
ORO19_RS14380 (ORO19_14380) 3033781..3034200 - 420 Protein_2837 winged helix-turn-helix domain-containing protein -
ORO19_RS14385 (ORO19_14385) 3034199..3034273 + 75 Protein_2838 hypothetical protein -
ORO19_RS14390 (ORO19_14390) 3034274..3034753 - 480 WP_003414073.1 dihydrofolate reductase -
ORO19_RS14395 (ORO19_14395) 3034824..3035624 - 801 WP_003911953.1 thymidylate synthase -
ORO19_RS14400 (ORO19_14400) 3035780..3036517 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T265029 WP_003414064.1 NZ_CP112996:c3032414-3032019 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT265029 WP_003414061.1 NZ_CP112996:c3031993-3031727 [Mycobacterium tuberculosis variant bovis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References