Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3031727..3032414 | Replicon | chromosome |
| Accession | NZ_CP112996 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TF65 |
| Locus tag | ORO19_RS14365 | Protein ID | WP_003414064.1 |
| Coordinates | 3032019..3032414 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | ORO19_RS14360 | Protein ID | WP_003414061.1 |
| Coordinates | 3031727..3031993 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO19_RS14330 (ORO19_14330) | 3027366..3028268 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| ORO19_RS14335 (ORO19_14335) | 3028337..3029089 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| ORO19_RS14340 (ORO19_14340) | 3029116..3029253 | - | 138 | Protein_2829 | type II toxin-antitoxin system VapC family toxin | - |
| ORO19_RS14345 (ORO19_14345) | 3029333..3029608 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| ORO19_RS14350 (ORO19_14350) | 3029605..3031227 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
| ORO19_RS14355 (ORO19_14355) | 3031314..3031730 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
| ORO19_RS14360 (ORO19_14360) | 3031727..3031993 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| ORO19_RS14365 (ORO19_14365) | 3032019..3032414 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ORO19_RS14370 (ORO19_14370) | 3032411..3032680 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| ORO19_RS14375 (ORO19_14375) | 3032690..3033784 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
| ORO19_RS14380 (ORO19_14380) | 3033781..3034200 | - | 420 | Protein_2837 | winged helix-turn-helix domain-containing protein | - |
| ORO19_RS14385 (ORO19_14385) | 3034199..3034273 | + | 75 | Protein_2838 | hypothetical protein | - |
| ORO19_RS14390 (ORO19_14390) | 3034274..3034753 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| ORO19_RS14395 (ORO19_14395) | 3034824..3035624 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
| ORO19_RS14400 (ORO19_14400) | 3035780..3036517 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T265029 WP_003414064.1 NZ_CP112996:c3032414-3032019 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|