Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2902096..2902810 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | ORO19_RS13600 | Protein ID | WP_003413460.1 |
Coordinates | 2902370..2902810 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | ORO19_RS13595 | Protein ID | WP_003413456.1 |
Coordinates | 2902096..2902383 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS13560 (ORO19_13560) | 2897518..2897763 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
ORO19_RS13565 (ORO19_13565) | 2897760..2898164 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO19_RS13570 (ORO19_13570) | 2898381..2899001 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
ORO19_RS13575 (ORO19_13575) | 2899012..2899506 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
ORO19_RS13580 (ORO19_13580) | 2899503..2899934 | + | 432 | WP_003413445.1 | DUF4247 domain-containing protein | - |
ORO19_RS13585 (ORO19_13585) | 2899959..2900417 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
ORO19_RS13590 (ORO19_13590) | 2900414..2901985 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
ORO19_RS13595 (ORO19_13595) | 2902096..2902383 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
ORO19_RS13600 (ORO19_13600) | 2902370..2902810 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS13605 (ORO19_13605) | 2902831..2903586 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
ORO19_RS13610 (ORO19_13610) | 2903719..2904315 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
ORO19_RS13615 (ORO19_13615) | 2904323..2905168 | - | 846 | WP_010950749.1 | acyl-CoA thioesterase II | - |
ORO19_RS13620 (ORO19_13620) | 2905197..2906096 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
ORO19_RS13625 (ORO19_13625) | 2906224..2906898 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T265027 WP_003413460.1 NZ_CP112996:2902370-2902810 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |