Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2902096..2902810 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag ORO19_RS13600 Protein ID WP_003413460.1
Coordinates 2902370..2902810 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag ORO19_RS13595 Protein ID WP_003413456.1
Coordinates 2902096..2902383 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS13560 (ORO19_13560) 2897518..2897763 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
ORO19_RS13565 (ORO19_13565) 2897760..2898164 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS13570 (ORO19_13570) 2898381..2899001 + 621 WP_003413441.1 DUF4178 domain-containing protein -
ORO19_RS13575 (ORO19_13575) 2899012..2899506 + 495 WP_003413444.1 DUF2617 family protein -
ORO19_RS13580 (ORO19_13580) 2899503..2899934 + 432 WP_003413445.1 DUF4247 domain-containing protein -
ORO19_RS13585 (ORO19_13585) 2899959..2900417 + 459 WP_003413451.1 DUF350 domain-containing protein -
ORO19_RS13590 (ORO19_13590) 2900414..2901985 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
ORO19_RS13595 (ORO19_13595) 2902096..2902383 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
ORO19_RS13600 (ORO19_13600) 2902370..2902810 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO19_RS13605 (ORO19_13605) 2902831..2903586 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
ORO19_RS13610 (ORO19_13610) 2903719..2904315 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
ORO19_RS13615 (ORO19_13615) 2904323..2905168 - 846 WP_010950749.1 acyl-CoA thioesterase II -
ORO19_RS13620 (ORO19_13620) 2905197..2906096 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
ORO19_RS13625 (ORO19_13625) 2906224..2906898 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T265027 WP_003413460.1 NZ_CP112996:2902370-2902810 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT265027 WP_003413456.1 NZ_CP112996:2902096-2902383 [Mycobacterium tuberculosis variant bovis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References