Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2841749..2842386 | Replicon | chromosome |
| Accession | NZ_CP112996 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P0DMV7 |
| Locus tag | ORO19_RS13335 | Protein ID | WP_003413180.1 |
| Coordinates | 2841749..2842144 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ44 |
| Locus tag | ORO19_RS13340 | Protein ID | WP_003413183.1 |
| Coordinates | 2842141..2842386 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO19_RS13295 (ORO19_13295) | 2837834..2838493 | + | 660 | WP_031702625.1 | LppA family lipoprotein | - |
| ORO19_RS13300 (ORO19_13300) | 2838490..2839149 | + | 660 | WP_003900847.1 | LppA family lipoprotein | - |
| ORO19_RS13305 (ORO19_13305) | 2839146..2839808 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| ORO19_RS13310 (ORO19_13310) | 2839805..2840083 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| ORO19_RS13315 (ORO19_13315) | 2840176..2840589 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| ORO19_RS13320 (ORO19_13320) | 2840628..2840885 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | - |
| ORO19_RS13325 (ORO19_13325) | 2840882..2841259 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| ORO19_RS13330 (ORO19_13330) | 2841275..2841649 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| ORO19_RS13335 (ORO19_13335) | 2841749..2842144 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
| ORO19_RS13340 (ORO19_13340) | 2842141..2842386 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
| ORO19_RS13345 (ORO19_13345) | 2842797..2843216 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| ORO19_RS13350 (ORO19_13350) | 2843228..2844036 | - | 809 | Protein_2635 | shikimate dehydrogenase | - |
| ORO19_RS13355 (ORO19_13355) | 2844033..2845286 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| ORO19_RS13360 (ORO19_13360) | 2845279..2845791 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T265026 WP_003413180.1 NZ_CP112996:c2842144-2841749 [Mycobacterium tuberculosis variant bovis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5WZ4 | |
| PDB | 5WZF |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW31 |