Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2840628..2841259 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag ORO19_RS13325 Protein ID WP_003413174.1
Coordinates 2840882..2841259 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag ORO19_RS13320 Protein ID WP_003413167.1
Coordinates 2840628..2840885 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS13285 (ORO19_13285) 2835886..2836200 + 315 WP_009937839.1 hypothetical protein -
ORO19_RS13290 (ORO19_13290) 2836496..2837707 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
ORO19_RS13295 (ORO19_13295) 2837834..2838493 + 660 WP_031702625.1 LppA family lipoprotein -
ORO19_RS13300 (ORO19_13300) 2838490..2839149 + 660 WP_003900847.1 LppA family lipoprotein -
ORO19_RS13305 (ORO19_13305) 2839146..2839808 + 663 WP_003900848.1 LppA family lipoprotein -
ORO19_RS13310 (ORO19_13310) 2839805..2840083 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
ORO19_RS13315 (ORO19_13315) 2840176..2840589 + 414 WP_003413164.1 PIN domain nuclease -
ORO19_RS13320 (ORO19_13320) 2840628..2840885 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
ORO19_RS13325 (ORO19_13325) 2840882..2841259 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
ORO19_RS13330 (ORO19_13330) 2841275..2841649 - 375 WP_003413177.1 hypothetical protein -
ORO19_RS13335 (ORO19_13335) 2841749..2842144 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
ORO19_RS13340 (ORO19_13340) 2842141..2842386 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
ORO19_RS13345 (ORO19_13345) 2842797..2843216 - 420 WP_003413190.1 A24 family peptidase -
ORO19_RS13350 (ORO19_13350) 2843228..2844036 - 809 Protein_2635 shikimate dehydrogenase -
ORO19_RS13355 (ORO19_13355) 2844033..2845286 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
ORO19_RS13360 (ORO19_13360) 2845279..2845791 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T265025 WP_003413174.1 NZ_CP112996:2840882-2841259 [Mycobacterium tuberculosis variant bovis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT265025 WP_003413167.1 NZ_CP112996:2840628-2840885 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References