Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2779449..2780101 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPX1 |
Locus tag | ORO19_RS13030 | Protein ID | WP_003412752.1 |
Coordinates | 2779676..2780101 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | ORO19_RS13025 | Protein ID | WP_003412749.1 |
Coordinates | 2779449..2779670 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS13010 (ORO19_13010) | 2777689..2777895 | - | 207 | WP_003899347.1 | hypothetical protein | - |
ORO19_RS13015 (ORO19_13015) | 2778031..2778654 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
ORO19_RS13020 (ORO19_13020) | 2778644..2779396 | + | 753 | WP_003901416.1 | hypothetical protein | - |
ORO19_RS13025 (ORO19_13025) | 2779449..2779670 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
ORO19_RS13030 (ORO19_13030) | 2779676..2780101 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS13035 (ORO19_13035) | 2780124..2781305 | - | 1182 | WP_010950729.1 | dihydrolipoamide acetyltransferase family protein | - |
ORO19_RS13040 (ORO19_13040) | 2781302..2782348 | - | 1047 | WP_010950730.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
ORO19_RS13045 (ORO19_13045) | 2782359..2783462 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
ORO19_RS13050 (ORO19_13050) | 2783721..2784542 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
ORO19_RS13055 (ORO19_13055) | 2784539..2785096 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T265022 WP_003412752.1 NZ_CP112996:2779676-2780101 [Mycobacterium tuberculosis variant bovis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TPX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |