Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2387239..2387768 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag ORO19_RS11170 Protein ID WP_003411124.1
Coordinates 2387239..2387556 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag ORO19_RS11175 Protein ID WP_003411127.1
Coordinates 2387553..2387768 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS11140 (ORO19_11140) 2382260..2383336 + 1077 WP_003411110.1 hypothetical protein -
ORO19_RS11145 (ORO19_11145) 2383333..2383614 + 282 WP_003411112.1 DUF5703 family protein -
ORO19_RS11150 (ORO19_11150) 2383650..2384723 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
ORO19_RS11155 (ORO19_11155) 2384728..2385258 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
ORO19_RS11160 (ORO19_11160) 2385306..2386652 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
ORO19_RS11170 (ORO19_11170) 2387239..2387556 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORO19_RS11175 (ORO19_11175) 2387553..2387768 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
ORO19_RS11180 (ORO19_11180) 2388023..2389081 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
ORO19_RS11185 (ORO19_11185) 2389211..2389567 - 357 WP_003411130.1 hypothetical protein -
ORO19_RS11190 (ORO19_11190) 2389662..2390444 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
ORO19_RS11195 (ORO19_11195) 2390712..2391002 - 291 WP_003900476.1 YggT family protein -
ORO19_RS11200 (ORO19_11200) 2391164..2391820 - 657 WP_003411133.1 cell division protein SepF -
ORO19_RS11205 (ORO19_11205) 2391886..2392662 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T265021 WP_003411124.1 NZ_CP112996:c2387556-2387239 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT265021 WP_003411127.1 NZ_CP112996:c2387768-2387553 [Mycobacterium tuberculosis variant bovis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References